DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and Hspbp1

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_038955262.1 Gene:Hspbp1 / 246146 RGDID:628677 Length:361 Species:Rattus norvegicus


Alignment Length:130 Identity:27/130 - (20%)
Similarity:52/130 - (40%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            |||       |:::...|.|.:.||.....|.:: |:.|......|..|.......|.||:..:.
  Rat   218 EAG-------LLQFLRLDGFSVLMRAMQQQVQKL-KVKSAFLLQNLLVGHPEHKALPPGTLCSMG 274

  Fly   131 IGQPIMSVRSSDR--YKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERER------YEELRDD 187
            :.|.::::..::.  :...|:.||......||...:.....:.|..:..|.|      :||.:::
  Rat   275 MVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEE 339

  Fly   188  187
              Rat   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 27/130 (21%)
Hspbp1XP_038955262.1 Fes1 43..137 CDD:400776
armadillo repeat 135..172 CDD:293788
armadillo repeat 178..213 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.