DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and HSPBP1

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_005258757.1 Gene:HSPBP1 / 23640 HGNCID:24989 Length:431 Species:Homo sapiens


Alignment Length:93 Identity:22/93 - (23%)
Similarity:40/93 - (43%) Gaps:18/93 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQ--GTVAR 128
            |||       |:::...|.|.:.||.....|    :.|....|..||..:   .|.|:  ||:..
Human   220 EAG-------LLQFLRLDGFSVLMRAMQQQV----QKLKVKSAFLLQNLL---VGHPEHKGTLCS 270

  Fly   129 VRIGQPIMSVRSSDR--YKAQVIEALRR 154
            :.:.|.::::..::.  :...|:.||.|
Human   271 MGMVQQLVALVRTEHSPFHEHVLGALCR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 22/93 (24%)
HSPBP1XP_005258757.1 Fes1 45..139 CDD:312204
armadillo repeat 88..130 CDD:293788
armadillo repeat 137..174 CDD:293788
armadillo repeat 180..215 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.