DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10 and RPL10L

DIOPT Version :9

Sequence 1:NP_001262233.1 Gene:RpL10 / 43864 FlyBaseID:FBgn0024733 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_542784.1 Gene:RPL10L / 140801 HGNCID:17976 Length:214 Species:Homo sapiens


Alignment Length:209 Identity:161/209 - (77%)
Similarity:180/209 - (86%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEAL 65
            ||||||||||||||||||||||||||||.||||||||||||.|::|||..|:|||||||||||||
Human     1 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSEAL 65

  Fly    66 EAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVR 130
            ||.|||.|||:||.||:|.||:|:||||||||||||||||||||||||||||||||||||||||.
Human    66 EAARICANKYMVKSCGRDGFHMRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVH 130

  Fly   131 IGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGC 195
            |||.|||:|:..:.:..||||||||||||||||||::||||||||:..:.:|::.....|.||||
Human   131 IGQVIMSIRTKLQNEEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGC 195

  Fly   196 NVKYRPEHGPIAAW 209
            .|||.|.|||:..|
Human   196 GVKYVPSHGPLDKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10NP_001262233.1 PTZ00173 1..213 CDD:185498 161/209 (77%)
RPL10LNP_542784.1 PTZ00173 1..209 CDD:185498 160/207 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159320
Domainoid 1 1.000 273 1.000 Domainoid score I1795
eggNOG 1 0.900 - - E1_COG0197
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 353 1.000 Inparanoid score I2260
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62276
OrthoDB 1 1.010 - - D1215841at2759
OrthoFinder 1 1.000 - - FOG0002057
OrthoInspector 1 1.000 - - otm41637
orthoMCL 1 0.900 - - OOG6_100701
Panther 1 1.100 - - O PTHR11726
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1358
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.