DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HnRNP-K and HEK2

DIOPT Version :9

Sequence 1:NP_995906.1 Gene:HnRNP-K / 43862 FlyBaseID:FBgn0267791 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_009521.1 Gene:HEK2 / 852248 SGDID:S000000128 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:26/108 - (24%)
Similarity:54/108 - (50%) Gaps:19/108 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 ANGGPNGSPNAATNVPQGHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNS 469
            ::|.|. ||:.::        |...::.||:...|||||:|..||:.::..:...|.::....:.
Yeast   246 SSGEPT-SPSTSS--------NTRIELKIPELYVGAIIGRGMNRIKNLKTFTKTNIVVERKDDDD 301

  Fly   470 ND----RIITISGTPKQIQMAQYLLQQSVH------ENGRRNI 502
            .|    :.|..|..||.:::|:.:|.::::      ||.:|.:
Yeast   302 KDENFRKFIITSKFPKNVKLAESMLLKNLNTEIEKRENYKRKL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnRNP-KNP_995906.1 PCBP_like_KH 30..91 CDD:239089
PCBP_like_KH 103..167 CDD:239089
HEK2NP_009521.1 KH-I_Rnc1_rpt1 44..113 CDD:411883
KH-I_Rnc1_rpt2 158..226 CDD:411884
KH 257..330 CDD:197652 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343841
Domainoid 1 1.000 45 1.000 Domainoid score I3091
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10288
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1164
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.