DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HnRNP-K and AT5G09560

DIOPT Version :9

Sequence 1:NP_995906.1 Gene:HnRNP-K / 43862 FlyBaseID:FBgn0267791 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001318518.1 Gene:AT5G09560 / 830815 AraportID:AT5G09560 Length:600 Species:Arabidopsis thaliana


Alignment Length:160 Identity:42/160 - (26%)
Similarity:66/160 - (41%) Gaps:46/160 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV-----DDSQGPERTIQISADIEST----LE 85
            |.|||...|.||.||||.|..::|:....::::.|     |||  |.|.|:|...:.|.    |.
plant    31 TFRILCNVSQAGHVIGKHGGMVKKLHKSTESSIWVEKTPLDDS--PYRIIKIFGHVGSVSRVKLG 93

  Fly    86 IITEMLKYFEERDEDFDV----------------------------RLLIHQSLAGCVIGKGGQK 122
            :|...:...|:::::.:|                            .||:..|....||||.|:.
plant    94 VIVNNVSNREKKEQEQEVEVSRAQYALIRVFEALNFGDCTSSTVSCNLLMEGSHVVTVIGKNGEL 158

  Fly   123 IKEIRDRIGCRFLKVFSNVAPQSTDRVVQT 152
            ::.|.:..||       ||..:|.|..:.|
plant   159 MQRILEETGC-------NVQLRSHDLSICT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnRNP-KNP_995906.1 PCBP_like_KH 30..91 CDD:239089 24/69 (35%)
PCBP_like_KH 103..167 CDD:239089 17/78 (22%)
AT5G09560NP_001318518.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2078
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X348
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.