DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HnRNP-K and Igf2bp3

DIOPT Version :9

Sequence 1:NP_995906.1 Gene:HnRNP-K / 43862 FlyBaseID:FBgn0267791 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_038963480.1 Gene:Igf2bp3 / 312320 RGDID:1306512 Length:628 Species:Rattus norvegicus


Alignment Length:527 Identity:106/527 - (20%)
Similarity:183/527 - (34%) Gaps:127/527 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLRMKREMNDEGE----GPQDQKRNRRNEETVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV 64
            :||.:|.....|.    .|....:.:..:..:|:|:|:...||:|||.|..|:.:..|.::.:.|
  Rat   167 QLRGRRGPGQRGSSRQTSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDV 231

  Fly    65 ---DDSQGPERTIQI-------SADIESTLEII---TEMLKYFEERDEDFDVRLLIHQSLAGCVI 116
               :::...|::|.|       ||..:|.|||:   .:.:|:.||    ..:::|.|.:..|.:|
  Rat   232 HRKENTGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEE----IPLKILAHNNFVGRLI 292

  Fly   117 GKGGQKIKEIRDRIGCRF-LKVFSNVAPQSTDRVVQTVGKQSQVIEAVREVITLTRDTPIKGAIH 180
            ||.|:.:|:|......:. :.....:...:.:|.:...|......:|..|::...|::      :
  Rat   293 GKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRES------Y 351

  Fly   181 NYDPMNFDRVYADEYGGYGTGSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAGGARGNAGG 245
            ..|..:.:.:|........||.......|                                    
  Rat   352 ENDIASMNGLYHPLLASVSTGCTWRAAIQ------------------------------------ 380

  Fly   246 RGGADRFGGAAGGAVAGAGMGQRDNPFINPWANGG-------GGDVDGFGNNAGGAGGFAGNSFG 303
                     |.|.::   .|..||......:..|.       ...:.|...||.|.       |.
  Rat   381 ---------ATGTSI---HMYLRDKYTDTVFPRGSCILPKLQAHLIPGLNLNALGL-------FP 426

  Fly   304 GGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFSQNQGGTSSL--PSLGSFG 366
            ..:|.|              |...|..|.         ..|....|.|::..|..|  |:| |.|
  Rat   427 PTSGMP--------------PPTSGPPSA---------MTPPYPQFEQSETETVHLFIPAL-SVG 467

  Fly   367 QNPGGPGGLGNGLS--GGANGGVGTLGGANG-------AGGFNAVGGANGGPNGSPNAATNVPQG 422
            ...|..|.....||  .||:..:......:.       .|...|...|.|...|.......|...
  Rat   468 AIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPK 532

  Fly   423 HDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITID-EPLPNSNDRIIT-ISGTPKQIQM 485
            .:......:.:|...||.:|||||..:..::|.|||.:.:. :..|:.||:::. |:|.....|:
  Rat   533 EEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQV 597

  Fly   486 AQYLLQQ 492
            ||..:|:
  Rat   598 AQRKIQE 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnRNP-KNP_995906.1 PCBP_like_KH 30..91 CDD:239089 21/73 (29%)
PCBP_like_KH 103..167 CDD:239089 13/64 (20%)
Igf2bp3XP_038963480.1 RRM_SF 1..77 CDD:418427
RRM2_IGF2BP3 81..156 CDD:410039
KH-I_IGF2BP3_rpt1 197..272 CDD:411920 21/74 (28%)
KH-I 275..359 CDD:412160 17/93 (18%)
KH-I_IGF2BP3_rpt3 451..528 CDD:411926 18/77 (23%)
KH-I_IGF2BP1_rpt4 536..611 CDD:411927 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394765at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X348
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.