DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nej and GCN5

DIOPT Version :9

Sequence 1:NP_001188575.1 Gene:nej / 43856 FlyBaseID:FBgn0261617 Length:3282 Species:Drosophila melanogaster
Sequence 2:NP_011768.1 Gene:GCN5 / 853167 SGDID:S000003484 Length:439 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:38/150 - (25%)
Similarity:70/150 - (46%) Gaps:19/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1672 GAVDIKPKTETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLP-----------TLEKLYRQEPE 1725
            |....|.....||:.|..: |..    |:..:.||....|..|           .|.:| :....
Yeast   290 GLEQFKDLNNIKPIDPMTI-PGL----KEAGWTPEMDALAQRPKRGPHDAAIQNILTEL-QNHAA 348

  Fly  1726 SVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTS 1790
            :.||..||:.:.  :|||::.:|:||||.|:...:::.||....:::.|..|:|:|..:||.:.:
Yeast   349 AWPFLQPVNKEE--VPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENT 411

  Fly  1791 RVYRYCTKLSEVFEAEIDPV 1810
            ..|:|..:|.:.|..::..:
Yeast   412 SYYKYANRLEKFFNNKVKEI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nejNP_001188575.1 ZnF_TAZ 530..600 CDD:214717
KIX 946..1024 CDD:280354
Bromo_cbp_like 1705..1812 CDD:99927 31/116 (27%)
RING_CBP-p300 1824..1906 CDD:276805
PHD_CBP_p300 1908..1939 CDD:277032
HAT_KAT11 1970..2283 CDD:285432
ZZ_CBP 2339..2379 CDD:239077
ZnF_TAZ 2404..2476 CDD:214717
GCN5NP_011768.1 COG5076 77..439 CDD:227408 38/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.