DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nej and kat2b

DIOPT Version :9

Sequence 1:	NP_001188575.1	Gene:	nej / 43856	FlyBaseID:	FBgn0261617	Length:	3282	Species:	Drosophila melanogaster
Sequence 2:	NP_001038499.1	Gene:	kat2b / 563942	ZFINID:	ZDB-GENE-060503-207	Length:	796	Species:	Danio rerio

Alignment Length:	125	Identity:	34/125 - (27%)
Similarity:	60/125 - (48%)	Gaps:	15/125 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly  1679 KTETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDY 1743
            :|..|||          .|.|:.: :|::|.:.|...|.:: :..|.:.||..||....  .|.|
Zfish   674 ETGWKPL----------GKSKELK-DPDQLYSTLKNILTQV-KSHPNAWPFMEPVKKNE--APGY 724

  Fly  1744 FEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVF 1803
            :::::.||||.|:...:::..|:....::.|:..:|.|...||...|..|: |..|.|.|
Zfish   725 YQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYK-CANLLEKF 783

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nej	NP_001188575.1	ZnF_TAZ	530..600	CDD:214717
		KIX	946..1024	CDD:280354
		Bromo_cbp_like	1705..1812	CDD:99927	28/99 (28%)
		RING_CBP-p300	1824..1906	CDD:276805
		PHD_CBP_p300	1908..1939	CDD:277032
		HAT_KAT11	1970..2283	CDD:285432
		ZZ_CBP	2339..2379	CDD:239077
		ZnF_TAZ	2404..2476	CDD:214717
kat2b	NP_001038499.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		PCAF_N	40..293	CDD:310813
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	77..97
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	371..408
		Acetyltransf_1	488..588	CDD:306954
		Acetyl-CoA binding. /evidence=ECO:0000250\|UniProtKB:Q92830	540..542
		Acetyl-CoA binding. /evidence=ECO:0000250\|UniProtKB:Q92830	547..553
		Acetyl-CoA binding. /evidence=ECO:0000250\|UniProtKB:Q92830	578..581
		Bromo_gcn5_like	691..790	CDD:99941	27/97 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900