DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nej and Baz1b

DIOPT Version :9

Sequence 1:NP_001188575.1 Gene:nej / 43856 FlyBaseID:FBgn0261617 Length:3282 Species:Drosophila melanogaster
Sequence 2:NP_001178845.1 Gene:Baz1b / 368002 RGDID:1597089 Length:1476 Species:Rattus norvegicus


Alignment Length:269 Identity:65/269 - (24%)
Similarity:100/269 - (37%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1567 KQDDDIKKEFMDDSCGGNNDSSQMDC----------------------STGGGKGKNVNNDGTSM 1609
            |.:||  |..:.|.|   |.:..:.|                      :....:|:|...:.||.
  Rat  1190 KGEDD--KLILCDEC---NKAFHLFCLRPALYEVPDGEWQCPACQPPTARRNSRGRNYTEESTSE 1249

  Fly  1610 IKMEIKTEDGLDGEVKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGATG--- 1671
            .....::.|..:.|.:.:.|..|.:.||......        ..:.|.:..|..|..|...|   
  Rat  1250 DSEGDESGDEEEEEEEEEEEEEDYEVAGLRLRPR--------KTIRGKQSVIPAARPGRPPGKKS 1306

  Fly  1672 -GAVDIKPKTETKPLVPEPLAPNAGDKKK------KCQFNPEELRTALLPTLEKL--YRQEPESV 1727
             .|...:||.:|:  |.|.:.......::      ||    ||:       |.||  ||   .|.
  Rat  1307 HAARRSRPKDDTE--VDELVLQTKRSSRRQSLELQKC----EEI-------LHKLVKYR---FSW 1355

  Fly  1728 PFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRV 1792
            |||.||....  ..||::::..|||..|::.....|.|....|::.||..:|.||.|||.:.|.|
  Rat  1356 PFREPVTRDE--AEDYYDVIDHPMDFQTMQNKCSCGNYRSVQEFLTDVKQVFANAELYNCRGSHV 1418

  Fly  1793 YRYCTKLSE 1801
            .. |.:.:|
  Rat  1419 LS-CMEKTE 1426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nejNP_001188575.1 ZnF_TAZ 530..600 CDD:214717
KIX 946..1024 CDD:280354
Bromo_cbp_like 1705..1812 CDD:99927 34/99 (34%)
RING_CBP-p300 1824..1906 CDD:276805
PHD_CBP_p300 1908..1939 CDD:277032
HAT_KAT11 1970..2283 CDD:285432
ZZ_CBP 2339..2379 CDD:239077
ZnF_TAZ 2404..2476 CDD:214717
Baz1bNP_001178845.1 WAC_Acf1_DNA_bd 21..120 CDD:287503
DDT 602..666 CDD:214726
WHIM1 722..771 CDD:292246
WHIM2 897..925 CDD:292247
WHIM3 988..1026 CDD:292248
PHD_BAZ1B 1183..1228 CDD:277098 8/42 (19%)
Bromo_WSTF_like 1337..1433 CDD:99937 36/107 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.