powered by:
Protein Alignment nej and F22F1.3
DIOPT Version :9
Sequence 1: | NP_001188575.1 |
Gene: | nej / 43856 |
FlyBaseID: | FBgn0261617 |
Length: | 3282 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509376.2 |
Gene: | F22F1.3 / 184851 |
WormBaseID: | WBGene00017715 |
Length: | 245 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 23/69 - (33%) |
Similarity: | 37/69 - (53%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 957 LRNHLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQKE 1021
||.:::.|:|:...|..:.....|.||..|..||..:||..:|..:::.|||..||..|..:||.
Worm 20 LRQYMITKIVREAVPRPNSDAKNDARMIELKEYATFMEKKSFEKVQTKDEYYAELARIILSMQKH 84
Fly 1022 LEEK 1025
|:.:
Worm 85 LQSR 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5076 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.