DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nej and C29F9.5

DIOPT Version :9

Sequence 1:NP_001188575.1 Gene:nej / 43856 FlyBaseID:FBgn0261617 Length:3282 Species:Drosophila melanogaster
Sequence 2:NP_001355379.1 Gene:C29F9.5 / 183022 WormBaseID:WBGene00016220 Length:261 Species:Caenorhabditis elegans


Alignment Length:103 Identity:41/103 - (39%)
Similarity:52/103 - (50%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 IQQQLMLLLHAHKCNRRE---------NLNPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHC 576
            |.:||.||||||:|.||:         |......:|.:..|..||.||.||.:||:...|...||
 Worm    40 ISRQLGLLLHAHECVRRDIKIREAAEKNEPAPHAMCKIQDCVIMKEVLKHMTSCKEGPKCNSVHC 104

  Fly   577 ASSRQILLHYKTCQNSGCVICYPFRQNHSVFQNANVPP 614
            ||||.||.|:|.|.|..|.:|.|      :.:....||
 Worm   105 ASSRTILSHWKKCFNEECPVCKP------IIEQRTAPP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nejNP_001188575.1 ZnF_TAZ 530..600 CDD:214717 32/78 (41%)
KIX 946..1024 CDD:280354
Bromo_cbp_like 1705..1812 CDD:99927
RING_CBP-p300 1824..1906 CDD:276805
PHD_CBP_p300 1908..1939 CDD:277032
HAT_KAT11 1970..2283 CDD:285432
ZZ_CBP 2339..2379 CDD:239077
ZnF_TAZ 2404..2476 CDD:214717
C29F9.5NP_001355379.1 ZnF_TAZ 40..128 CDD:214717 39/93 (42%)
KIX 153..223 CDD:280354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166115
Domainoid 1 1.000 84 1.000 Domainoid score I5261
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2676
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.690

Return to query results.
Submit another query.