DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and stxbp4

DIOPT Version :10

Sequence 1:NP_524641.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_001037969.1 Gene:stxbp4 / 733742 XenbaseID:XB-GENE-973737 Length:516 Species:Xenopus tropicalis


Alignment Length:72 Identity:24/72 - (33%)
Similarity:41/72 - (56%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1243 SLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMS--HAETIGLFK 1305
            |||.|:|||....:..: |::|.:.|.|....||.|::||::|.:|...:.|:|  .|:.|....
 Frog    22 SLGLSLVGGISRAEEPL-IYIKDIIPGGDCHKDGRLKSGDQLVSVNKELLVGVSCEQAKCILNRA 85

  Fly  1306 NVREGTI 1312
            .:|:|.:
 Frog    86 KLRKGPV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_524641.1 PDZ_canonical <815..868 CDD:483948
PDZ3_PDZD2-PDZ1_hPro-IL-16-like 1231..1316 CDD:467240 24/72 (33%)
stxbp4NP_001037969.1 PDZ1_hSTXBP4-PDZ2_GgSTXBP4-like 12..99 CDD:467184 24/72 (33%)
Smc <215..>401 CDD:440809
WW 464..493 CDD:459800
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.