DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Pdzk1

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:130 Identity:33/130 - (25%)
Similarity:55/130 - (42%) Gaps:26/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1188 APPAAALMHHRPSLPVAKLTIRDEEMAEVIRASMSEGSGRCTPKTITFFKGPGLKSLGFSIVGGR 1252
            :|...||...:|.|                  .|:.|...|....:.:....| .|.|||:    
  Rat   108 SPREPALNEKKPDL------------------GMNGGVETCAQPRLCYLVKEG-NSFGFSL---- 149

  Fly  1253 DSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFKNVREGTIVLKIL 1317
            .:.:|..|:|:..:.|.|.|...|.| |.|.::|:||.:|:..||.|.:.  |..:.|:.::.:|
  Rat   150 KTIQGKKGVFLTDITPQGVAMKAGVL-ADDHLIEVNGENVENASHEEVVE--KVTKSGSRIMFLL 211

  Fly  1318  1317
              Rat   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492 24/86 (28%)
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492
PDZ 132..212 CDD:214570 25/88 (28%)
PDZ_signaling 242..320 CDD:238492
PDZ 375..455 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.