DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Synj2bp

DIOPT Version :10

Sequence 1:NP_524641.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_072121.2 Gene:Synj2bp / 64531 RGDID:69400 Length:145 Species:Rattus norvegicus


Alignment Length:97 Identity:34/97 - (35%)
Similarity:49/97 - (50%) Gaps:18/97 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1233 ITFFKGPGLKSLGFSIVGGRDSP--KGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGM 1295
            |...:||  ..|||:||||.|..  ..:.||:|..:...|.||.||.||.||:|:.:||..::.:
  Rat    14 INLTRGP--SGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAARDGRLQEGDKILSVNGQDLKNL 76

  Fly  1296 SHAETIGLFKN--------------VREGTIV 1313
            .|.:.:.||:|              |:.|.||
  Rat    77 LHQDAVDLFRNAGYAVSLRVQHRLPVQNGPIV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_524641.1 PDZ_canonical <815..868 CDD:483948
PDZ3_PDZD2-PDZ1_hPro-IL-16-like 1231..1316 CDD:467240 34/97 (35%)
Synj2bpNP_072121.2 PDZ_SYNJ2BP-like 12..97 CDD:467193 30/84 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.