DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_067605.1 Gene:Slc9a3r1 / 59114 RGDID:708538 Length:356 Species:Rattus norvegicus


Alignment Length:109 Identity:30/109 - (27%)
Similarity:50/109 - (45%) Gaps:7/109 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1220 SMSEGSGRCTPKTITFFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEI 1284
            |....:|...|:.....|||  ...||.:.|    .||.:|.|::.|.| |..|:...|.|||.:
  Rat     2 SADAAAGEPLPRLCCLEKGP--NGYGFHLHG----EKGKVGQFIRLVEP-GSPAEKSGLLAGDRL 59

  Fly  1285 VEINGNSVQGMSHAETIGLFKNVREGTIVLKILRRKLQKAKSMG 1328
            ||:||.:|:..:|.:.:...:.......:|.:.....::.|.:|
  Rat    60 VEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLKKLG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492 26/86 (30%)
Slc9a3r1NP_067605.1 PDZ_signaling 12..91 CDD:238492 26/85 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142
PDZ_signaling 149..228 CDD:238492
EBP50_C 232..356 CDD:286142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.