Sequence 1: | NP_001014543.1 | Gene: | a / 43852 | FlyBaseID: | FBgn0000008 | Length: | 1329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062391.3 | Gene: | Tamalin / 56149 | MGIID: | 1860303 | Length: | 392 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 60/206 - (29%) |
---|---|---|---|
Similarity: | 85/206 - (41%) | Gaps: | 42/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1153 KHSPKSVSLFSPNPYVNASSSPASASTSAGAGSSLAPPAAALMHHRPSLPVAKL--TIRDEEMAE 1215
Fly 1216 VIRA--------SMSEGSG------RCTP----KTITFFKGPGLKSLGFSI----VGGRDSPKGN 1258
Fly 1259 MGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFK---NVRE-----GTIVLK 1315
Fly 1316 I-LRRKLQKAK 1325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
a | NP_001014543.1 | PDZ_signaling | 775..865 | CDD:238492 | |
PDZ_signaling | 1230..1317 | CDD:238492 | 32/103 (31%) | ||
Tamalin | NP_062391.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | 14/48 (29%) | |
PDZ_signaling | 99..184 | CDD:238492 | 28/86 (33%) | ||
Interaction with PSCD3. /evidence=ECO:0000269|PubMed:10828067 | 180..257 | 8/25 (32%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..315 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |