DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and PDZD11

DIOPT Version :10

Sequence 1:NP_524641.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:XP_016885057.1 Gene:PDZD11 / 51248 HGNCID:28034 Length:172 Species:Homo sapiens


Alignment Length:124 Identity:38/124 - (30%)
Similarity:57/124 - (45%) Gaps:28/124 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1189 PPAAALMH---HRPSLPVAKLTIRDEEMAEVIRASMSEGSGRCTPKTITFFKGPGLKSLGFSIVG 1250
            |||....|   |.|..        :.|:.:.:            |:|||..|.||.: |||:|.|
Human    53 PPAWIPPHERVHHPDY--------NNELTQFL------------PRTITLKKPPGAQ-LGFNIRG 96

  Fly  1251 GRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFKNVRE 1309
            |:.|   .:|||:..|.|...|...| ||.||:::.:|....|.:.|::.:.:.|..||
Human    97 GKAS---QLGIFISKVIPDSDAHRAG-LQEGDQVLAVNDVDFQDIEHSKAVEILKTARE 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_524641.1 PDZ_canonical <815..868 CDD:483948
PDZ3_PDZD2-PDZ1_hPro-IL-16-like 1231..1316 CDD:467240 30/79 (38%)
PDZD11XP_016885057.1 PDZ_PDZD11-like 78..160 CDD:467234 30/79 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.