DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Zasp66

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster


Alignment Length:424 Identity:83/424 - (19%)
Similarity:140/424 - (33%) Gaps:115/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 EATSLHRQQQQPHQPPTIYVPVPTKLGNN----------------VNTGNSSATLLLSYGSTSSI 205
            |..:.:|.|..| :||.:.:|.|.:..::                |..|:.:...||.....|.|
  Fly    24 ELPTSYRPQPTP-KPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKI 87

  Fly   206 ANLQQQQQQHAAQYQQY---------VAQRLHAASSSCLYEKGS--NASGGASSNKSSLSLTPN- 258
            .....:...||...|.:         |..|    .:...|.:|:  .|..|:.||.:...:||: 
  Fly    88 GEYDARDLSHADAQQLFRGAGNEIRLVVHR----DNKIAYTQGATQEAGPGSRSNSTLPPVTPDL 148

  Fly   259 ----GHLP------DYKLVTAMPVVVLDDEHKSNSLPATEASRNSNSSSNMNGSSNSNSLDVSNS 313
                |..|      .::....:||         ::||.| .....|||......|...|...:..
  Fly   149 MPHRGPSPFLPGPSHFERALQLPV---------DTLPQT-VFPQLNSSGGYEVPSTVFSPKPTRD 203

  Fly   314 NSHSGSSTSLA------STTRNVFTWGKRMSRKL----DLLKRSDSPAA-AHKSHSDLRSLF--- 364
            :.........|      .||..|.. |.::.:..    ..|:...:||. ||..|....|:.   
  Fly   204 HQQDVDEEQAAIVNQPYRTTPLVLP-GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQR 267

  Fly   365 --HSPTHHKSGSGGSSGPSSAKASASPTGGHQNSS-----GST----TSTLKKCKSGPI------ 412
              .:..|...||...:|....|...||.|.:.|::     .||    ||...:.|..|:      
  Fly   268 VADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPT 332

  Fly   413 ------ETIKQRHQQQQQQQQSVQDVGTGQSQSAQSTP--------THQFQ-------------- 449
                  :|: |...:..:..:::|:.| |.|...||:|        |..:|              
  Fly   333 KLNGYKKTV-QYDPRNSETYRAIQEEG-GYSNYGQSSPQEVTIPVQTKVYQPNRLVPGKKPVSAP 395

  Fly   450 AAARPQKALKNFFHRIGSTGMLNHRSHNLLKASE 483
            .:..|...:......|..:|..|...::::.|:|
  Fly   396 VSRPPYNVVNTHDENIRQSGSFNRLMYSVIGATE 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/46 (20%)
DUF4749 285..359 CDD:292558 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.