DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and CG15617

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_611151.1 Gene:CG15617 / 36871 FlyBaseID:FBgn0034151 Length:222 Species:Drosophila melanogaster


Alignment Length:67 Identity:22/67 - (32%)
Similarity:32/67 - (47%) Gaps:9/67 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1245 GFSIVGGRD--SPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLF-KN 1306
            |..:.||.|  .|     :.:..|.|:| .|..|.::.||||.:||......|:..|.:.:| ||
  Fly    44 GMEVTGGIDQFEP-----LTIVNVSPTG-LAKRGGMRVGDEITQINDVPALEMTFNEALQMFRKN 102

  Fly  1307 VR 1308
            .|
  Fly   103 SR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492 22/67 (33%)
CG15617NP_611151.1 PDZ_signaling 30..111 CDD:238492 22/67 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.