DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Slc9a3r1

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_036160.1 Gene:Slc9a3r1 / 26941 MGIID:1349482 Length:355 Species:Mus musculus


Alignment Length:201 Identity:51/201 - (25%)
Similarity:78/201 - (38%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1123 PSSTATTTTDLTNQQQQQQN----QQQTHQSLY--IKHSPKSVSLFSPNPYVNASSS-------- 1173
            |.|.|..:..|...:..:.|    :::|||.:.  |:.:..:|.|...:|..:....        
Mouse    44 PGSPAEKSGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDERLKKLGVSIRE 108

  Fly  1174 ----PASASTSAGAGSSLAPPAAALMHHRPSLPVAKLTIRDEEMAEVIRASMSEGSGRCTPKTIT 1234
                |...|..|      .|||||..|.          ..|:..||  ::.:.|    ..|:..|
Mouse   109 ELLRPQEKSEQA------EPPAAADTHE----------AGDQNEAE--KSHLRE----LRPRLCT 151

  Fly  1235 FFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAE 1299
            ..|||  ...||::    .|.|...|.|::.|.|...|...| |:|.|.|||:||..::|..|.:
Mouse   152 MKKGP--NGYGFNL----HSDKSKPGQFIRAVDPDSPAEASG-LRAQDRIVEVNGVCMEGKQHGD 209

  Fly  1300 TIGLFK 1305
            .:...|
Mouse   210 VVSAIK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492 26/76 (34%)
Slc9a3r1NP_036160.1 PDZ_signaling 12..91 CDD:238492 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..146 13/57 (23%)
PDZ_signaling 147..226 CDD:238492 26/76 (34%)
EBP50_C 230..355 CDD:286142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.