Sequence 1: | NP_001014543.1 | Gene: | a / 43852 | FlyBaseID: | FBgn0000008 | Length: | 1329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036160.1 | Gene: | Slc9a3r1 / 26941 | MGIID: | 1349482 | Length: | 355 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 78/201 - (38%) | Gaps: | 47/201 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1123 PSSTATTTTDLTNQQQQQQN----QQQTHQSLY--IKHSPKSVSLFSPNPYVNASSS-------- 1173
Fly 1174 ----PASASTSAGAGSSLAPPAAALMHHRPSLPVAKLTIRDEEMAEVIRASMSEGSGRCTPKTIT 1234
Fly 1235 FFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAE 1299
Fly 1300 TIGLFK 1305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
a | NP_001014543.1 | PDZ_signaling | 775..865 | CDD:238492 | |
PDZ_signaling | 1230..1317 | CDD:238492 | 26/76 (34%) | ||
Slc9a3r1 | NP_036160.1 | PDZ_signaling | 12..91 | CDD:238492 | 11/46 (24%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 110..146 | 13/57 (23%) | |||
PDZ_signaling | 147..226 | CDD:238492 | 26/76 (34%) | ||
EBP50_C | 230..355 | CDD:286142 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 244..355 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |