DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Synj2bp

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_079568.1 Gene:Synj2bp / 24071 MGIID:1344347 Length:145 Species:Mus musculus


Alignment Length:101 Identity:35/101 - (34%)
Similarity:51/101 - (50%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1229 TPKTITFFKGPGLKSLGFSIVGGRDSP--KGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNS 1291
            |.:.|...:||  ..|||:||||.|..  ..:.||:|..:...|.||.||.||.||:|:.:||..
Mouse    10 TEEEINLTRGP--SGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQD 72

  Fly  1292 VQGMSHAETIGLFKN--------------VREGTIV 1313
            ::.:.|.:.:.||:|              |:.|.||
Mouse    73 LKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492 34/100 (34%)
Synj2bpNP_079568.1 PDZ_signaling 13..97 CDD:238492 30/85 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.