DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and Cytip

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:338 Identity:79/338 - (23%)
Similarity:114/338 - (33%) Gaps:95/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 ALKNFFHRIGSTGMLN------HRSHNLLKASEAAQQ-------ATPAAT--------TLYRSSS 500
            :|:.|..|.||.|.|.      :.|:::|......:.       |...||        .|.||||
Mouse     2 SLQRFLQRQGSNGNLEYCADSAYGSYSVLTGQLTMEDNRRIQVLADTVATLPRGRKQLALARSSS 66

  Fly   501 TSQLSSS-----SYVKCDDPTEGLNLQREQREQRLPRIASLKSSSCDDIAKVSSCLTASTSSGSA 560
            ....|.|     :..|.|:.|.|..:|    ..||.......|..|..|.||        ...|.
Mouse    67 LGDFSWSQRKVVTVEKQDNGTFGFEIQ----TYRLQNQNICSSEVCTMICKV--------QEDSP 119

  Fly   561 AGSLGSPPSSAAAGGGGTANSGQHDPSRRGAFPYA----FLRSRLSVLPEENHGNVPGH------ 615
            |...|.......|...|.:..|         |.:.    .:||..::|..|.......|      
Mouse   120 AHCAGLQVGDIFANVNGVSTEG---------FTHKQVVDLIRSSGNLLTIETLNGTMIHRRAELE 175

  Fly   616 -----LKQQIQRQ----REQHQQHQRDLLQQEQTSSPLPQRR------------SPEQAMLNNVS 659
                 |||.::::    |..|.|.|| ||..:..:||..:..            .|..|:|:...
Mouse   176 AKLQTLKQTLKKKWVELRSLHLQEQR-LLHGDTANSPNLENMDLDESSLFGNLLGPSPALLDRHR 239

  Fly   660 RNDSITSKDWEPLYQRLSSCLSSNESGY------DSDGGATGARLGNN---LSISGGDTESIASG 715
            .:...:.|.|      |||....:|.||      ||..||...:...:   .....|| |.:.:.
Mouse   240 LSSESSCKSW------LSSLTVDSEDGYRSSMSEDSIRGAFSRQTSTDDECFHSKDGD-EILRNA 297

  Fly   716 TLKRNSLISLSSS 728
            :.:||..||::||
Mouse   298 SSRRNRSISVTSS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 22/105 (21%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.