DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and LNX2

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_699202.1 Gene:LNX2 / 222484 HGNCID:20421 Length:690 Species:Homo sapiens


Alignment Length:663 Identity:139/663 - (20%)
Similarity:223/663 - (33%) Gaps:175/663 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   681 SSNESGYDSDGGATGARLGNNLSISGGDTESIASGTL---KRNSLISLSS-SEGVGM-GMGMSLG 740
            |..::..:::.|.|.......||   .:.:.:.:|.:   :..:..|||: ||..|: .......
Human   153 SRTQAEIENENGPTLLDPAGTLS---PEADCLGTGAVPVERHLTSASLSTWSEEPGLDNPAFEES 214

  Fly   741 LGAPSTRNSSICSAPVSLGGYNYDYETETIRRRFRQVKLERKCQEDYIGIVLSPKTVMTNSNEQQ 805
            .||.:|:.      |:||.    :.|..||       ::.|  ...||.:.:|    :...||..
Human   215 AGADTTQQ------PLSLP----EGEITTI-------EIHR--SNPYIQLGIS----IVGGNETP 256

  Fly   806 YRYLIVELEPY--GMAQKDGRLRLGDEIVNVNGKHLRGI-QSFAEVQRLLSSFVDNCIDLVIAHD 867
            ...:::: |.|  |:..:||||..||:|:.||..::..: .::|   |.:.|...|.:.|.:..:
Human   257 LINIVIQ-EVYRDGVIARDGRLLAGDQILQVNNYNISNVSHNYA---RAVLSQPCNTLHLTVLRE 317

  Fly   868 EVTTVTDFYTKIRIDGMSTQRHRLSYVQRTQSTDSLSSMQSLQLQQERIQGHNTEQEQEAQGEDQ 932
                        |..|.....|          :||.|..:  ::.|..:...::.::...:...:
Human   318 ------------RRFGNRAHNH----------SDSNSPRE--EIFQVALHKRDSGEQLGIKLVRR 358

  Fly   933 CDARSMASVSTMPTPMPLMQHRRSSTPR------HSLDVGAPEHELLRRRARSSSGQRSLALTPT 991
            .|...:..:..:...:.....|.||..|      |.|..|.||   |..:...:||:|.......
Human   359 TDEPGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKYGTPE---LAAQIIQASGERVNLTIAR 420

  Fly   992 PLFASGSSSCSSSPNHRLLDNENDPANDTDSYTPVYANRAAS-----VCVASSLADDEKWQLLAR 1051
            |......::...:.||......:.|        |.|.:|.:|     .||.              
Human   421 PGKPQPGNTIREAGNHSSSSQHHTP--------PPYYSRPSSHKDLTQCVT-------------- 463

  Fly  1052 KRCSEGSALSATPNPQQFGQRTHYARNSINLANSHYRSLRFAHSRLSSSRLSLFM-QAPPNSLTV 1115
              |.|..........:..|......|.|                  .|..|.:|: ..||:....
Human   464 --CQEKHITVKKEPHESLGMTVAGGRGS------------------KSGELPIFVTSVPPHGCLA 508

  Fly  1116 GEG-VANTPSSTATTTTDLTNQQQQQQNQQQTHQSLYIKHSPKSVSLFSPNPYVNASSSPASAST 1179
            .:| :............|||                                  |.|.|.|.|..
Human   509 RDGRIKRGDVLLNINGIDLT----------------------------------NLSHSEAVAML 539

  Fly  1180 SAGAGSSLAPPAAALMHHRPSLPVAKLTIRDEEMAEVIRASMSEGSGRCTPKTITFFKGPG---- 1240
            .|.|.|    ||.||......: |.:.|...||.....  |.:|.....:|..:.:...|.    
Human   540 KASAAS----PAVALKALEVQI-VEEATQNAEEQPSTF--SENEYDASWSPSWVMWLGLPSTLHS 597

  Fly  1241 ----------LKSLGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGM 1295
                      |.|.|||||||.:....|...|:||:.....|..||.|:.||.||.:||.|..||
Human   598 CHDIVLRRSYLGSWGFSIVGGYEENHTNQPFFIKTIVLGTPAYYDGRLKCGDMIVAVNGLSTVGM 662

  Fly  1296 SHAETIGLFKNVR 1308
            ||:..:.:.|..|
Human   663 SHSALVPMLKEQR 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492 23/92 (25%)
PDZ_signaling 1230..1317 CDD:238492 32/93 (34%)
LNX2NP_699202.1 mRING-HC-C3HC3D_LNX2 45..89 CDD:319694
modified RING-HC finger (C3HC3D-type) 50..87 CDD:319694
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 7/31 (23%)
NPXY motif 208..211 0/2 (0%)
PDZ 230..316 CDD:214570 26/102 (25%)
PDZ 336..422 CDD:214570 15/88 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..455 7/44 (16%)
PDZ_signaling 466..542 CDD:238492 18/127 (14%)
PDZ_signaling 599..683 CDD:238492 30/77 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19964
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.