DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and F28E10.4

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_500590.2 Gene:F28E10.4 / 185067 WormBaseID:WBGene00017902 Length:324 Species:Caenorhabditis elegans


Alignment Length:267 Identity:52/267 - (19%)
Similarity:91/267 - (34%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   969 EHELLRRRARSSSGQRSLALTPTPLFASGSSSCSSSPNHR--LLDNENDPANDTDS--------- 1022
            :.||||..|.:....|...:||........|.|:....|.  :||.|..|...|.|         
 Worm    78 QSELLRGTACNVEVSRRKGVTPVTCERLAKSGCNLRKGHACFVLDVERPPHMTTTSVGLKLGIIK 142

  Fly  1023 ----YTPVYANRAASV---CVASSLADDEKWQLLARKRCSEGSALSATPNPQQFGQRTHYAR--- 1077
                .|.|..|..||.   | ..|:.|            ..|:.:..|.||..| .|.|.:|   
 Worm   143 RRAFVTKVDPNTIASSFFGC-GDSIMD------------MSGAPIPMTDNPDNF-IREHLSRLST 193

  Fly  1078 -----------NSINLANSHYR---SLRFAHSRLSSSRLSLFMQAPPNSLTVGEGVAN------- 1121
                       .|:.:|..:.:   |:.:..|.:..::         :.:.:|...:|       
 Worm   194 GAKVSFLVERPISVAMAKQYQKFIESITYDDSEVEMAQ---------DVIEIGREASNMHFMILK 249

  Fly  1122 ---TPSSTATTTTDLTNQQQ-QQQNQQQTHQSLYIKHSPKSVSLFSP-------NPYVNASSSPA 1175
               |||   ..::|:..::: ..:..:.|..|:.|..:...:.:.|.       .|..:.|.:..
 Worm   250 KLVTPS---ILSSDVRRRKKSNNKTSESTEGSITISSASTEMKITSDVTDFDDLKPVESKSHAAG 311

  Fly  1176 SASTSAG 1182
            |:|:.:|
 Worm   312 SSSSDSG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492
F28E10.4NP_500590.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.