DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and mics-1

DIOPT Version :10

Sequence 1:NP_524641.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_001343863.1 Gene:mics-1 / 179475 WormBaseID:WBGene00011890 Length:293 Species:Caenorhabditis elegans


Alignment Length:123 Identity:31/123 - (25%)
Similarity:61/123 - (49%) Gaps:30/123 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1200 SLPVAKLTIRDEEMAEVIRASMSEGSGRCTPKTITFFKGPGLKSLGFSIVGGRDSPK--GNMGIF 1262
            |:|:..||:     .|:.:.|                     |..||:||||.|:|.  |::||:
 Worm    65 SVPLEALTV-----VEIEKTS---------------------KGFGFNIVGGTDNPHFVGDIGIY 103

  Fly  1263 VKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFKNVREGTIVLKILRRK 1320
            |.:|  :.::...|.::.||:|:..:|..:...:|.|.:.:|::|:.|.:...::.|:
 Worm   104 VSSV--NSESKSYGVVRTGDKILSFDGIDMTYKTHDEAVEVFRSVKIGHVAKMLIDRE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_524641.1 PDZ_canonical <815..868 CDD:483948
PDZ3_PDZD2-PDZ1_hPro-IL-16-like 1231..1316 CDD:467240 24/86 (28%)
mics-1NP_001343863.1 PDZ_canonical 73..147 CDD:483948 24/101 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.