Sequence 1: | NP_001014543.1 | Gene: | a / 43852 | FlyBaseID: | FBgn0000008 | Length: | 1329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003199223.2 | Gene: | cytip / 100537036 | ZFINID: | ZDB-GENE-140106-76 | Length: | 343 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 48/195 - (24%) |
---|---|---|---|
Similarity: | 78/195 - (40%) | Gaps: | 40/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1143 QQQTHQSLYIKHSPKSVSLFSPNPYVNASSSPASASTSAGAGSSLAPPAAALMHHRPSL----PV 1203
Fly 1204 AKLTIRDEEMAEVIRASMSEGSGRCTPKTITFFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFP 1268
Fly 1269 SGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFKNVREGTIVLKI------LRRKLQKAKSM 1327
Fly 1328 1327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
a | NP_001014543.1 | PDZ_signaling | 775..865 | CDD:238492 | |
PDZ_signaling | 1230..1317 | CDD:238492 | 29/92 (32%) | ||
cytip | XP_003199223.2 | PDZ_signaling | 78..162 | CDD:238492 | 31/110 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |