DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and cytip

DIOPT Version :9

Sequence 1:NP_001014543.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:XP_003199223.2 Gene:cytip / 100537036 ZFINID:ZDB-GENE-140106-76 Length:343 Species:Danio rerio


Alignment Length:195 Identity:48/195 - (24%)
Similarity:78/195 - (40%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1143 QQQTHQSLYIKHSPKSVSLFSPNPYVNASSSPASASTSAGAGSSLAPPAAALMHHRPSL----PV 1203
            |..:..|..|..|.|..|:....   .:.|||.:.:|....|.:|:....|..|....:    |.
Zfish    14 QMSSLDSYIIDSSQKKRSILWRQ---RSFSSPKNLNTEGMKGRTLSQSQLARTHSNSLVDYTDPQ 75

  Fly  1204 AKLTIRDEEMAEVIRASMSEGSGRCTPKTITFFKGPGLKSLGFSIVGGRDSPKGNMGIFVKTVFP 1268
            ..:.:.:::..||....:.           |:    |||....|:|        .|..||..| .
Zfish    76 RTMVVLEKQDNEVFGFEVQ-----------TY----GLKVKNTSMV--------EMCTFVCRV-Q 116

  Fly  1269 SGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFKNVREGTIVLKI------LRRKLQKAKSM 1327
            .|.||:...|.|||.|:.:||.|::|.:|...|.|   :||.:..||:      :.::::..|.|
Zfish   117 DGSAAETAGLTAGDIILSVNGVSIEGSTHQNIIEL---IRESSNTLKLETVSGSVMKRIELEKKM 178

  Fly  1328  1327
            Zfish   179  178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_001014543.1 PDZ_signaling 775..865 CDD:238492
PDZ_signaling 1230..1317 CDD:238492 29/92 (32%)
cytipXP_003199223.2 PDZ_signaling 78..162 CDD:238492 31/110 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.