DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a and synj2bp

DIOPT Version :10

Sequence 1:NP_524641.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster
Sequence 2:NP_001106384.1 Gene:synj2bp / 100127193 XenbaseID:XB-GENE-954530 Length:145 Species:Xenopus tropicalis


Alignment Length:108 Identity:40/108 - (37%)
Similarity:63/108 - (58%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1221 MSEGSGRCTPKTITFFKGPGLKSLGFSIVGGRDSP--KGNMGIFVKTVFPSGQAADDGTLQAGDE 1283
            ||.|: ....:.|...:||  ..|||:|:||.|..  ..:.||:|.::...|.||.||.||.||:
 Frog     1 MSAGA-LAAVEEIALTRGP--SGLGFNIIGGTDQDYIAHDSGIYVSSIKEKGSAAADGRLQEGDQ 62

  Fly  1284 IVEINGNSVQGMSHAETIGLFKNVREGTIVLKILRRKLQKAKS 1326
            |:|:||..::.:.|:..:.||:|..| .:|||: |.|:|..::
 Frog    63 ILEVNGVKLEDLLHSAAVDLFRNAGE-HVVLKV-RHKVQNQQN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aNP_524641.1 PDZ_canonical <815..868 CDD:483948
PDZ3_PDZD2-PDZ1_hPro-IL-16-like 1231..1316 CDD:467240 33/86 (38%)
synj2bpNP_001106384.1 PDZ_SYNJ2BP-like 10..95 CDD:467193 34/88 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.