DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and ABF2

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_013788.1 Gene:ABF2 / 855094 SGDID:S000004676 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:75 Identity:20/75 - (26%)
Similarity:41/75 - (54%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 KRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHP 488
            |||.:|:.::.:|.|.:.:|..|.:..:.||||.|.:|:.:....|:.|..|:.:|...:.:...
Yeast    44 KRPTSAYFLYLQDHRSQFVKENPTLRPAEISKIAGEKWQNLEADIKEKYISERKKLYSEYQKAKK 108

  Fly   489 DYRYRPRPKR 498
            ::..:..||:
Yeast   109 EFDEKLPPKK 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 19/73 (26%)
ABF2NP_013788.1 NHP6B 1..183 CDD:227935 20/75 (27%)

Return to query results.
Submit another query.