DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox11

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_445801.1 Gene:Sox11 / 84046 RGDID:69351 Length:395 Species:Rattus norvegicus


Alignment Length:232 Identity:79/232 - (34%)
Similarity:96/232 - (41%) Gaps:61/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQ 486
            ||||||||||||:|.|||||::..|||||:.|||.||.|||.:.:::|.|:..|..||...||..
  Rat    48 HIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMAD 112

  Fly   487 HPDYRYRPRPK-RTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCAD-ACPKGS 549
            :|||:||||.| :|..........|..|.....:.|:             |.|..||. ..|.|.
  Rat   113 YPDYKYRPRKKPKTDPAAKPSAGQSPDKSAAGAKAAK-------------GPGKKCAKLKAPAGK 164

  Fly   550 GGSNSQV------AVAAAAAVY------------HLQ-----DMASSAASTAHGHDCGHTPPQQF 591
            .|:....      |..||..|:            .||     |........||.|   ..||...
  Rat   165 AGAGKAAQPGDCGAGKAAKCVFLDDDDEEDDEDDELQLRPKPDADDDDDEPAHSH---LLPPPAQ 226

  Fly   592 FYPPESL-------------------SPSGFS-SDEV 608
            ..||:.|                   ||.|.| .|||
  Rat   227 QQPPQLLRRYSVAKVPASPTLSSAAESPEGASLYDEV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 46/76 (61%)
Sox11NP_445801.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
HMG-box_SoxC_SOX11 38..129 CDD:438846 47/80 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..258 37/159 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..312
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 363..395
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.