DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and HMGB3

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001031075.1 Gene:HMGB3 / 838659 AraportID:AT1G20696 Length:147 Species:Arabidopsis thaliana


Alignment Length:40 Identity:9/40 - (22%)
Similarity:22/40 - (55%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 IEVLGPFTVVMKII----------GCAIESTVVSILLKFG 285
            ::::.|.|.:.::|          |..:|:|:|:..:|:|
plant   141 LQIVEPTTEMKRVIDKIVDFIQKNGKELEATLVAQDVKYG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848
HMGB3NP_001031075.1 HMG-box_AtHMGB1-like 36..96 CDD:438821
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.