DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SOX7

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_113627.1 Gene:SOX7 / 83595 HGNCID:18196 Length:388 Species:Homo sapiens


Alignment Length:341 Identity:99/341 - (29%)
Similarity:129/341 - (37%) Gaps:138/341 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 ALDPESLNSGQLGP-VPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKIL 442
            |||.| |:.||..| ||..|              |:.|   |:..|:||||||||||||||:::.
Human    18 ALDAE-LSDGQSPPAVPRPP--------------GDKG---SESRIRRPMNAFMVWAKDERKRLA 64

  Fly   443 KACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPR----PKRTC-IV 502
            ...||:||:.:||:||..|||::.:.|:||.:|..||...||:.:|:|:||||    .||.| .|
Human    65 VQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKKQAKRLCKRV 129

  Fly   503 DGKKMRISEYKVLMRNRRA--EMRQLWCRTGGVSGGSGSL--------------------CADAC 545
            |...:..|    |.|::.|  |.|         ||..|:|                    |....
Human   130 DPGFLLSS----LSRDQNALPEKR---------SGSRGALGEKEDRGEYSPGTALPSLRGCYHEG 181

  Fly   546 PKGSGGSNSQVAVAAAAAVYHL---------------QDMASSAASTAHGH-------------- 581
            |.|.||..:..:|....  |.|               |...||.....|||              
Human   182 PAGGGGGGTPSSVDTYP--YGLPTPPEMSPLDVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSP 244

  Fly   582 -------DCGH---------------------TPPQQFFYPPES--------------LSP---- 600
                   .|.|                     .||...:|.|.:              |||    
Human   245 EYAPSPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEH 309

  Fly   601 SGFSSDEVELASQREL 616
            .||  |.::..||.||
Human   310 PGF--DALDQLSQVEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 36/70 (51%)
SOX7NP_113627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..46 12/43 (28%)
SOX-TCF_HMG-box 44..115 CDD:238684 36/70 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..197 14/65 (22%)
Sox_C_TAD 198..386 CDD:288887 24/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.