DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and 3xHMG-box1

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_192846.1 Gene:3xHMG-box1 / 826709 AraportID:AT4G11080 Length:446 Species:Arabidopsis thaliana


Alignment Length:139 Identity:35/139 - (25%)
Similarity:56/139 - (40%) Gaps:41/139 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 KRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSK------- 481
            |||...:::|.||...::.|..|:......|.||||:||.:|..:|:| |||:.:..|       
plant   130 KRPSTPYILWCKDNWNEVKKQNPEADFKETSNILGAKWKGISAEEKKP-YEEKYQADKEAYLQVI 193

  Fly   482 -----------------------------LHMEQHPDYRYRPRPKRTCIVDGKKMR--ISEYKVL 515
                                         ||..|..::..:.:.|:  |.|..|.:  ||.|.:.
plant   194 TKEKREREAMKLLDDEQKQKTAMELLDQYLHFVQEAEHDNKKKAKK--IKDPLKPKQPISAYLIY 256

  Fly   516 MRNRRAEMR 524
            ...|||.::
plant   257 ANERRAALK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 25/109 (23%)
3xHMG-box1NP_192846.1 PTZ00121 <11..361 CDD:173412 35/139 (25%)
HMG-box_AtHMGB6-like_rpt1 130..197 CDD:438822 22/67 (33%)
HMG-box_AtHMGB6-like_rpt2 246..311 CDD:438823 6/20 (30%)
HMG-box_AtHMGB6-like_rpt3 363..440 CDD:438824
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.