DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox12

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001162121.1 Gene:Sox12 / 689988 RGDID:1586313 Length:314 Species:Rattus norvegicus


Alignment Length:303 Identity:84/303 - (27%)
Similarity:110/303 - (36%) Gaps:117/303 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 GPVPASPSSQPLRQGNGHGHGGNHGHVHSKP--------HIKRPMNAFMVWAKDERRKILKACPD 447
            ||.|..|.  |..:|            ..:|        ||||||||||||::.|||||:...||
  Rat    14 GPPPPGPG--PAAEG------------AREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPD 64

  Fly   448 MHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEY 512
            |||:.|||.||.||:.:.:::|.|:..|..||...||..:|||:||||         ||.:.:..
  Rat    65 MHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPR---------KKSKGAPA 120

  Fly   513 KVLMR---------------------NRRAEMRQLWCRTGGVSGGSGSLCAD------------- 543
            |...|                     .|||        |||..||..:...|             
  Rat   121 KARPRPPGGGGGGSRLKPGPQLPGRGGRRA--------TGGPLGGGAAAPEDDDEDEEEELLEVR 177

  Fly   544 -----------ACPKG---------SGGSNSQVAVAAAAAVYHLQD-----MASSAASTAHGHD- 582
                       ..|.|         :.|.:|:.|.|:||:....:|     ....||:...|.: 
  Rat   178 LLETPGRELWRMVPAGRAARGPAERAQGPSSEGAAASAASPTLSEDEEPEEEEEEAATAEEGEEE 242

  Fly   583 -----------CGHTPP-------QQFFYPPESLSPSGFSSDE 607
                       ....||       ......|:.|.|||.|..|
  Rat   243 TVASGEEPLGFLSRMPPGPTGLDCSALDRDPDLLPPSGTSHFE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 39/70 (56%)
Sox12NP_001162121.1 SOX-TCF_HMG-box 39..110 CDD:238684 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.