DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SRY

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_003131.1 Gene:SRY / 6736 HGNCID:11311 Length:204 Species:Homo sapiens


Alignment Length:180 Identity:54/180 - (30%)
Similarity:81/180 - (45%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 GHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRL 479
            |:|..:  :|||||||:||::|:|||:....|.|.||.|||.||.:||.::.|:|.|:::|..:|
Human    54 GNVQDR--VKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKL 116

  Fly   480 SKLHMEQHPDYRYRPR------PKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSG 538
            ..:|.|::|:|:||||      ||...::......:...:|.:.||                   
Human   117 QAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNR------------------- 162

  Fly   539 SLCADACPKGSGGSNSQVAVAAAAAVYHLQDMASSAASTAHGHDCGHTPP 588
             |..|.|.|                          |..:...|..||.||
Human   163 -LYRDDCTK--------------------------ATHSRMEHQLGHLPP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 33/70 (47%)
SRYNP_003131.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000269|PubMed:15297880 59..136 37/78 (47%)
SOX-TCF_HMG-box 59..130 CDD:238684 33/72 (46%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:12764225, ECO:0000269|PubMed:15746192 61..77 11/15 (73%)
Sufficient for interaction with EP300. /evidence=ECO:0000269|PubMed:15297880 107..139 11/31 (35%)
Required for nuclear localization. /evidence=ECO:0000269|PubMed:15297880 130..136 3/5 (60%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 138..155 2/16 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..204 5/11 (45%)
Necessary for interaction with SLC9A3R2. /evidence=ECO:0000269|PubMed:9054412 198..204
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.