DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SOX4

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_003098.1 Gene:SOX4 / 6659 HGNCID:11200 Length:474 Species:Homo sapiens


Alignment Length:294 Identity:94/294 - (31%)
Similarity:122/294 - (41%) Gaps:71/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 NSERS-AALDPESLNSG---QLG----PVPASPSSQPLRQGNGHGHGGNHGHVHSKP-------- 421
            |:|.: |.|..||.:||   :||    |.|.|.:|.          ||.    ...|        
Human     7 NAENTEALLAGESSDSGAGLELGIASSPTPGSTAST----------GGK----ADDPSWCKTPSG 57

  Fly   422 HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQ 486
            ||||||||||||::.|||||::..|||||:.|||.||.|||.:.::||.|:..|..||...||..
Human    58 HIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMAD 122

  Fly   487 HPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACPKG--- 548
            :|||:||||.|   :..|.....|......:......:......||..||.|...::|...|   
Human   123 YPDYKYRPRKK---VKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGA 184

  Fly   549 -SGGSNSQVA----------------------------------VAAAAAVYHLQDMASSAASTA 578
             .||:||:.|                                  .|||||.....:.|.:||...
Human   185 SGGGANSKPAQKKSCGSKVAGGAGGGVSKPHAKLILAGGGGGGKAAAAAAASFAAEQAGAAALLP 249

  Fly   579 HGHDCGHTPPQQFFYPPESLSPSGFSSDEVELAS 612
            .|....|....:...|..|.|.|..:|....||:
Human   250 LGAAADHHSLYKARTPSASASASSAASASAALAA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 41/70 (59%)
SOX4NP_003098.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 17/64 (27%)
SOX-TCF_HMG-box 58..129 CDD:238684 41/70 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..228 19/102 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..286 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148464
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.