Sequence 1: | NP_001014695.1 | Gene: | Sox102F / 43844 | FlyBaseID: | FBgn0039938 | Length: | 618 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003097.1 | Gene: | SOX2 / 6657 | HGNCID: | 11195 | Length: | 317 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 69/207 - (33%) |
---|---|---|---|
Similarity: | 97/207 - (46%) | Gaps: | 50/207 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 397 PSSQPLRQGNGHGH------GGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISK 455
Fly 456 ILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRR 520
Fly 521 AEMRQLWCRTGGVSGGSGSLCADACPKGSG---GSNSQVAVAAAAAVYHLQDMASSAAS------ 576
Fly 577 --------TAHG 580 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox102F | NP_001014695.1 | SOX-TCF_HMG-box | 422..493 | CDD:238684 | 39/70 (56%) |
SOX2 | NP_003097.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..43 | 8/33 (24%) | |
SOX-TCF_HMG-box | 40..111 | CDD:238684 | 39/70 (56%) | ||
SOXp | 110..200 | CDD:315092 | 22/106 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 243..266 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 297..317 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |