DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SOX2

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_003097.1 Gene:SOX2 / 6657 HGNCID:11195 Length:317 Species:Homo sapiens


Alignment Length:207 Identity:69/207 - (33%)
Similarity:97/207 - (46%) Gaps:50/207 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PSSQPLRQGNGHGH------GGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISK 455
            |.......|.|.|:      |||  ..:|...:||||||||||::.:|||:.:..|.||||.|||
Human    11 PPGPQQTSGGGGGNSTAAAAGGN--QKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISK 73

  Fly   456 ILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRR 520
            .|||.||.:|..:|:|:.:|..||..|||::||||:||||.|.              |.||:   
Human    74 RLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT--------------KTLMK--- 121

  Fly   521 AEMRQLWCRTGGVSGGSGSLCADACPKGSG---GSNSQVAVAAAAAVYHLQDMASSAAS------ 576
               :..:...||:....|:..|.....|:|   |.|.::...|     |:...::.:.|      
Human   122 ---KDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYA-----HMNGWSNGSYSMMQDQL 178

  Fly   577 --------TAHG 580
                    .|||
Human   179 GYPQHPGLNAHG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 39/70 (56%)
SOX2NP_003097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 8/33 (24%)
SOX-TCF_HMG-box 40..111 CDD:238684 39/70 (56%)
SOXp 110..200 CDD:315092 22/106 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..266
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.