DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SOX17

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_071899.1 Gene:SOX17 / 64321 HGNCID:18122 Length:414 Species:Homo sapiens


Alignment Length:267 Identity:79/267 - (29%)
Similarity:117/267 - (43%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 SRDSVNSCGTNSERSAALDPESLNSGQLGPVPASPSSQPL--------RQGNGHGHGGNHGHVHS 419
            |.|:..:....|:..:||  .::.:| |||.|.:.|..|:        ...|.....|..|....
Human     3 SPDAGYASDDQSQTQSAL--PAVMAG-LGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKG 64

  Fly   420 KPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHM 484
            :..|:||||||||||||||:::.:..||:||:.:||:||..|||::.|:|:|:.||..||...||
Human    65 ESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHM 129

  Fly   485 EQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACPKGS 549
            :.||:|:||||                       ||.::::|....||...|    .|:......
Human   130 QDHPNYKYRPR-----------------------RRKQVKRLKRVEGGFLHG----LAEPQAAAL 167

  Fly   550 GGSNSQVAVAAAAAVYHLQDMASSAA-----STAHGHDC---GHTPPQQFFYPPESLSP-SGFSS 605
            |....:||:......:..|...:...     ...|..||   |..|...:..|....|| .|...
Human   168 GPEGGRVAMDGLGLQFPEQGFPAGPPLLPPHMGGHYRDCQSLGAPPLDGYPLPTPDTSPLDGVDP 232

  Fly   606 DEVELAS 612
            |....|:
Human   233 DPAFFAA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)
SOX17NP_071899.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..66 4/29 (14%)
SOX-TCF_HMG-box 67..138 CDD:238684 38/70 (54%)
Sox_C_TAD 201..412 CDD:288887 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..286
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.