DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox9b

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_571719.1 Gene:sox9b / 60642 ZFINID:ZDB-GENE-001103-2 Length:407 Species:Danio rerio


Alignment Length:349 Identity:89/349 - (25%)
Similarity:131/349 - (37%) Gaps:125/349 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 GSRATRVSRDSVNS-C-----GTNSERSAALDPESLNSGQLGPVPASPSSQPLRQG--------- 405
            |:.:..:|.||..| |     |::||...|..|...:..:..||....:...:.:|         
Zfish    14 GAPSPSLSEDSAGSPCASAGSGSDSETPRAEPPLHRDEQEKFPVCIRDAVSQVLKGYDWSLVPMP 78

  Fly   406 ---NGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNA 467
               :|.|        .||||:|||||||||||:..|||:....|.:||:.:||.||..|:.::..
Zfish    79 VRVSGSG--------KSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEG 135

  Fly   468 DKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTC------IVDGKKMRISEYKVLMRNRRAEMRQL 526
            :|:|:.||..||...|.:.||||:|:||.:::.      ..||::.:||...:....:|||... 
Zfish   136 EKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKSGSAESEDGEQTQISTNALFRALQRAETPD- 199

  Fly   527 WCRTG------------------------------------------------GVSGGS---GSL 540
             ..||                                                |:..|:   |.|
Zfish   200 -SSTGELHSPGEHSGQSQGPPTPPTTPKTDLPVCSKADLKRERERDRERPLQDGIDFGAVDIGEL 263

  Fly   541 CADAC----------------------PKGSGGSNSQVAVAAAAAVYHLQDMASSAASTAHGH-- 581
            .:|..                      |.|:|.|:..    .:||..|....:||.|:....|  
Zfish   264 SSDVISNIEAFDVNEFDQYLPPHGAPGPAGAGFSSGY----GSAAWMHKPLASSSMANAGEQHQQ 324

  Fly   582 ---------DCGH---TPPQQFFY 593
                     ..||   .||||.||
Zfish   325 RAQIKTEQLSPGHYSQQPPQQQFY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 34/70 (49%)
sox9bNP_571719.1 Sox_N 16..80 CDD:372113 13/63 (21%)
SOX-TCF_HMG-box 90..160 CDD:238684 34/69 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.