Sequence 1: | NP_001014695.1 | Gene: | Sox102F / 43844 | FlyBaseID: | FBgn0039938 | Length: | 618 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032751.1 | Gene: | sox1b / 562710 | ZFINID: | ZDB-GENE-060322-5 | Length: | 340 | Species: | Danio rerio |
Alignment Length: | 261 | Identity: | 92/261 - (35%) |
---|---|---|---|
Similarity: | 118/261 - (45%) | Gaps: | 78/261 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 396 SPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGAR 460
Fly 461 WKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQ 525
Fly 526 LWCRTGGVSGGSG-----SLCADAC--------PKGSGGS----------------NSQVAVAAA 561
Fly 562 AAVYHLQDM-------ASSAASTAHGHDCGHTP--PQQFF--------YPP-------ESLSPSG 602
Fly 603 F 603 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox102F | NP_001014695.1 | SOX-TCF_HMG-box | 422..493 | CDD:238684 | 40/70 (57%) |
sox1b | NP_001032751.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | 8/24 (33%) | |
SOX-TCF_HMG-box | 36..107 | CDD:238684 | 40/70 (57%) | ||
SOXp | 106..>198 | CDD:289133 | 28/112 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 198..219 | 8/22 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |