DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox1b

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001032751.1 Gene:sox1b / 562710 ZFINID:ZDB-GENE-060322-5 Length:340 Species:Danio rerio


Alignment Length:261 Identity:92/261 - (35%)
Similarity:118/261 - (45%) Gaps:78/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 SPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGAR 460
            ||.:| .....|| .|.|.|...::..:||||||||||::.:|||:.:..|.||||.|||.|||.
Zfish    12 SPGAQ-TNTNTGH-TGPNSGSKVNQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAE 74

  Fly   461 WKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQ 525
            ||.||.|:|:|:.:|..||..:||::||||:||||.|.              |.|::..:..:  
Zfish    75 WKLMSEAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKT--------------KTLLKKDKYSL-- 123

  Fly   526 LWCRTGGVSGGSG-----SLCADAC--------PKGSGGS----------------NSQVAVAAA 561
                .||:..|||     .|...|.        |.|.|||                :.|||.|||
Zfish   124 ----AGGLLAGSGGGGGVGLGMGAAGVGQRLESPVGHGGSTAASYAHMNGWTNGAYSGQVAAAAA 184

  Fly   562 AAVYHLQDM-------ASSAASTAHGHDCGHTP--PQQFF--------YPP-------ESLSPSG 602
            ||.. :|:.       ..|.|...|||.  |.|  ||...        |.|       .|.||||
Zfish   185 AAAM-MQEAQLAYGQHPGSGAHHHHGHH--HHPHNPQPMHRYEMTALQYSPLSNSQSYMSASPSG 246

  Fly   603 F 603
            :
Zfish   247 Y 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 40/70 (57%)
sox1bNP_001032751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 8/24 (33%)
SOX-TCF_HMG-box 36..107 CDD:238684 40/70 (57%)
SOXp 106..>198 CDD:289133 28/112 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..219 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.