DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox12

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001025449.1 Gene:sox12 / 562381 ZFINID:ZDB-GENE-040724-33 Length:355 Species:Danio rerio


Alignment Length:114 Identity:54/114 - (47%)
Similarity:70/114 - (61%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 GHVHSKP----------HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADK 469
            |||.|..          ||||||||||||::.|||||::..|||||:.|||.||.|||.:.:.:|
Zfish    35 GHVPSNKDPNWCKTPTGHIKRPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEK 99

  Fly   470 QPYYEEQSRLSKLHMEQHPDYRYRPRPK---RTCIVDGKKMRISEYKVL 515
            .|:.:|..||...||..:|||:||||.|   .|.:..|:|:.:...|.|
Zfish   100 IPFIKEAERLRLKHMADYPDYKYRPRKKSKGSTPVKLGEKLPMKSSKPL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 40/70 (57%)
sox12NP_001025449.1 SOX-TCF_HMG-box 52..123 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.