DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SOX18

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_060889.1 Gene:SOX18 / 54345 HGNCID:11194 Length:384 Species:Homo sapiens


Alignment Length:161 Identity:62/161 - (38%)
Similarity:87/161 - (54%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 CGTNSERSAALDPESLNSGQLG----PVPASP---------SSQPLRQG-NGHGHGGNHGHVHSK 420
            |.......||.|...|.:|...    ..||||         |.:|.|.| :..|.|.......|:
Human    20 CAWAPGHGAAADTRGLAAGPAALAAPAAPASPPSPQRSPPRSPEPGRYGLSPAGRGERQAADESR 84

  Fly   421 PHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHME 485
              |:||||||||||||||:::.:..||:||:.:||:||..||.::.|:|:|:.||..||...|:.
Human    85 --IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLR 147

  Fly   486 QHPDYRYRPRPKRTCIVDGKKMRISEYKVLM 516
            .||:|:||||.|:    ..:|.|..|..:|:
Human   148 DHPNYKYRPRRKK----QARKARRLEPGLLL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 36/70 (51%)
SOX18NP_060889.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 18/69 (26%)
SOX-TCF_HMG-box 84..155 CDD:238684 36/72 (50%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 87..100 12/12 (100%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 111..123 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..218 12/33 (36%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 166..231 3/9 (33%)
Sox_C_TAD 193..382 CDD:288887
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148449
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.