DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox3

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001007502.1 Gene:sox3 / 493228 XenbaseID:XB-GENE-484815 Length:307 Species:Xenopus tropicalis


Alignment Length:279 Identity:82/279 - (29%)
Similarity:123/279 - (44%) Gaps:71/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 PLRQGN----GHGHGGNHGH--VHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGA 459
            |::|.|    |.|..|..|:  :..:..:||||||||||::.:|||:.:..|.||||.|||.|||
 Frog    12 PVQQSNAPNGGPGTPGGKGNASIPDQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGA 76

  Fly   460 RWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRA--- 521
            .||.:|:::|:|:.:|..||..:||:::|||:||||.|...::  ||.:.|    |..|..|   
 Frog    77 DWKLLSDSEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLL--KKDKYS----LPGNLLAPGV 135

  Fly   522 ----------EMRQLWCRTGGVSGGSGSLCADA----------CPK--------GSGG------- 551
                      :....:....|.:.|:.||..|.          .|:        ..||       
 Frog   136 SPVASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPGMNSPQMQQIQHRYDMGGLQYSPMM 200

  Fly   552 SNSQVAVAAAAAVYHLQDMASSAASTAHG-HDCGHTPPQQFFYPPES------------------ 597
            |::|..:.|||:.|.:....:..:||... ...|.....:...||.:                  
 Frog   201 SSAQTYMNAAASTYSMSPAYNQQSSTVMSLGSMGSVVKSEPSSPPPAITSHTQRACLGDLRDMIS 265

  Fly   598 --LSPSGFSSDEVELASQR 614
              |.|.|.:||...|.|.|
 Frog   266 MYLPPGGDASDPSSLQSSR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 37/70 (53%)
sox3NP_001007502.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 7/28 (25%)
SOX-TCF_HMG-box 39..110 CDD:238684 37/70 (53%)
SOXp 109..189 CDD:372055 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.