DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and LOC4577482

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:XP_001238271.1 Gene:LOC4577482 / 4577482 VectorBaseID:AGAMI1_010672 Length:111 Species:Anopheles gambiae


Alignment Length:103 Identity:26/103 - (25%)
Similarity:50/103 - (48%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 KPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHM 484
            ||  |||::|:|:|....|.:|.|..|.:..:.|:|..|..|:.|.  ||..:..:.:::...:.
Mosquito     4 KP--KRPLSAYMLWLNSAREQIKKENPGIKVTEIAKKGGELWRGMK--DKSEWEYKAAKMKDEYN 64

  Fly   485 EQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAE 522
            :|..|:......|..    |.|.:....||:.::::.:
Mosquito    65 KQMQDFERNGGSKDA----GTKKKKGAKKVVKKSKKKD 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 20/76 (26%)
LOC4577482XP_001238271.1 HMG-box_SSRP1-like 7..71 CDD:438810 18/65 (28%)

Return to query results.
Submit another query.