DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and SoxN

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster


Alignment Length:456 Identity:115/456 - (25%)
Similarity:166/456 - (36%) Gaps:163/456 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SPTYENPPYEILSYSHNTPPESPHGR------TADCSKNFSPSPTDNL-----------SIASVS 278
            ||.....|...|..||.|..:..|..      :|..:.:.||:|..:|           .:....
  Fly    32 SPYSALAPLMNLGQSHLTHSQLSHHNHHHHHMSAHIAASQSPNPLSSLQSSMANTLNGSQVGQQQ 96

  Fly   279 EAQDSEMDAPLNLSKPKGSPSSSPNSSSQRDHCENLTPVVSSPPLSWHQGQPHYAEIELPLLKSH 343
            :.|..:..:||:     .|...||..||...|  ::|..||.   ..|..|..:.:      :.|
  Fly    97 QQQQQQQSSPLH-----SSSELSPTQSSIGSH--HMTSPVSH---QQHTQQQQHGQ------QQH 145

  Fly   344 GRVWNSAVACSGGSRATRVSRDSVNSCGTNSERSAALDPESLNSGQLGPVPASPSSQPLRQGNGH 408
            ....::..:.:|||     |.::.||...|..:..|                             
  Fly   146 LGAGSALSSLTGGS-----SNNNNNSATANKNQQHA----------------------------- 176

  Fly   409 GHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYY 473
                        ..:||||||||||::.:|||:....|.||||.|||.|||:||.:|.::|:|:.
  Fly   177 ------------DRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFI 229

  Fly   474 EEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGG------ 532
            :|..||..:||::||||:||||.|...:...|:    :|.:                ||      
  Fly   230 DEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKE----KYPM----------------GGLMPGQT 274

  Fly   533 VSGGS-----------GSLCADACPKGSGGSNSQVAVAAAAA-------VYHLQ----------- 568
            |.||:           |....:....|||||.:..|.|||||       :|.:.           
  Fly   275 VGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYM 339

  Fly   569 ---DMASSAA---------STAHGHDCGH-----------------TPPQQFFYPPESLSPSGFS 604
               |.|.:||         ..|..:|.||                 :|.......|.|.||.|.|
  Fly   340 MHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGS 404

  Fly   605 S 605
            |
  Fly   405 S 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451305
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.