DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and tHMG1

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster


Alignment Length:83 Identity:26/83 - (31%)
Similarity:41/83 - (49%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 KRPMNAFMVWAKDERRKILKA-CPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQH 487
            |:||:|||:|.....||.:|| .||.....:|...|..|:||::.||..:.|..:.....:.|:.
  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73

  Fly   488 PDYRYRPRPKR----TCI 501
            ..:.: |:..|    .||
  Fly    74 KQWNF-PKEHRFSDTQCI 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 23/74 (31%)
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 22/66 (33%)

Return to query results.
Submit another query.