DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox21b

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b / 406246 ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio


Alignment Length:197 Identity:69/197 - (35%)
Similarity:100/197 - (50%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 SKP--HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSK 481
            |||  |:||||||||||::.:|||:.:..|.||||.|||.|||.||.::.::|:|:.:|..||..
Zfish     2 SKPMDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRA 66

  Fly   482 LHMEQHPDYRYRPRPKRTCIVDGKKM------RISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSL 540
            :||::||||:||||.|...::...|.      .:.|::.|             :.||:..|    
Zfish    67 MHMKEHPDYKYRPRRKPKTLMKKDKFAFPVAYNLGEHEAL-------------KVGGLPAG---- 114

  Fly   541 CADACPKGSGGSNSQVAVAAAAAVYHLQDMASSAASTAHGHDCG----HTPPQQFFYPPESLSPS 601
               |..:....:..:.|.|||||...:....|.:|:.....|.|    ...|..|.|    .||.
Zfish   115 ---ALTESLMSNPDKAAAAAAAAAARVFFNPSMSANPYSFFDLGSKMTELSPPSFSY----ASPL 172

  Fly   602 GF 603
            |:
Zfish   173 GY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)
sox21bNP_001009888.1 SOX-TCF_HMG-box 7..78 CDD:238684 38/70 (54%)
SOXp 77..>95 CDD:289133 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.