DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and hmgb2

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_988904.1 Gene:hmgb2 / 394499 XenbaseID:XB-GENE-1000246 Length:212 Species:Xenopus tropicalis


Alignment Length:82 Identity:21/82 - (25%)
Similarity:39/82 - (47%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 GGNHGHVHSKPHI-KRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYE 474
            |...|.....|:. |||.:||.::..:.|.:|....|.:...:.:|.||..|...:..||.||.:
 Frog    83 GEKKGKKKKDPNAPKRPPSAFFLFCSEHRPQIKSESPGLSIGDTAKKLGEMWSEQTPKDKLPYEQ 147

  Fly   475 EQSRLSKLHMEQHPDYR 491
            :.::|.:.:.:....|:
 Frog   148 KAAKLKEKYEKDVAAYK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 19/72 (26%)
hmgb2NP_988904.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
HMG-box_HMGB_rpt2 94..164 CDD:438795 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.