DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox7

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001074219.1 Gene:sox7 / 394203 ZFINID:ZDB-GENE-040109-4 Length:390 Species:Danio rerio


Alignment Length:244 Identity:82/244 - (33%)
Similarity:109/244 - (44%) Gaps:62/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PSSQPLRQGNGHGHGGNHGH-----VHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKI 456
            |.|.....||.....|:..|     ..|:|.|:||||||||||||||:::....||:||:.:||:
Zfish    12 PESFECSAGNADVPDGHTSHRAPADKVSEPRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKM 76

  Fly   457 LGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRP----KRTCIVDGKKMRISEYKVLM- 516
            ||..|||::...|:||.||..||...||:.:|:|:||||.    ||.|      .|:....:|. 
Zfish    77 LGKSWKALTPPQKRPYVEEAERLRVQHMQDYPNYKYRPRRKKQLKRIC------KRVDPGFLLTT 135

  Fly   517 ----RNRRAEMRQLWCR------TGGVSGGSGSLCADACPKGSGGSNSQVAVAAAAAVYHLQDMA 571
                :|...:.|.. |.      ..|||||.||                 ..||...|...:|.|
Zfish   136 LGPDQNSLPDPRGC-CHPLDKDDESGVSGGFGS-----------------PGAALPGVRVFRDPA 182

  Fly   572 SSAAS---TAHGHDCGHTPP------------QQFFYPPESLSPSGFSS 605
            ||.:|   ..:|..   |||            |.::....|:|.|..||
Zfish   183 SSNSSFDTYPYGLP---TPPEMSPLDAVDHEHQSYYSSSSSVSTSSCSS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 37/70 (53%)
sox7NP_001074219.1 SOX-TCF_HMG-box 42..113 CDD:238684 37/70 (53%)
Sox_C_TAD 174..388 CDD:288887 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.