Sequence 1: | NP_001014695.1 | Gene: | Sox102F / 43844 | FlyBaseID: | FBgn0039938 | Length: | 618 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998283.1 | Gene: | sox2 / 378723 | ZFINID: | ZDB-GENE-030909-1 | Length: | 315 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 71/205 - (34%) |
---|---|---|---|
Similarity: | 98/205 - (47%) | Gaps: | 45/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 397 PSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARW 461
Fly 462 KAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQL 526
Fly 527 WCRTGGVSGGSGSLCADACPKGSG-GSNSQVAVAAAAAVYHLQDMASSAASTAHGHDCGHT---- 586
Fly 587 --PPQQFFYP 594 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox102F | NP_001014695.1 | SOX-TCF_HMG-box | 422..493 | CDD:238684 | 40/70 (57%) |
sox2 | NP_998283.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..41 | 8/28 (29%) | |
SOX-TCF_HMG-box | 37..108 | CDD:238684 | 40/70 (57%) | ||
SOXp | 107..197 | CDD:289133 | 25/110 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 235..263 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 296..315 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |