DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox2

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_998283.1 Gene:sox2 / 378723 ZFINID:ZDB-GENE-030909-1 Length:315 Species:Danio rerio


Alignment Length:205 Identity:71/205 - (34%)
Similarity:98/205 - (47%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARW 461
            |:.||...|.|:.:...:...:|...|||||||||||::.:|||:.:..|.||||.|||.|||.|
Zfish    12 PAPQPNTGGTGNTNSSGNNQKNSPDRIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEW 76

  Fly   462 KAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQL 526
            |.:|.::|:|:.:|..||..|||::||||:||||.|.              |.||:..:..:   
Zfish    77 KLLSESEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT--------------KTLMKKDKYTL--- 124

  Fly   527 WCRTGGVSGGSGSLCADACPKGSG-GSNSQVAVAAAAAVYHLQDMASSAASTAHGHDCGHT---- 586
                      .|.|.|   |.|:| |:...|.....|.|....|        ::.|..|.|    
Zfish   125 ----------PGGLLA---PGGNGMGAGVGVGAGLGAGVNQRMD--------SYAHMNGWTNGGY 168

  Fly   587 --PPQQFFYP 594
              ..:|..||
Zfish   169 GMMQEQLGYP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 40/70 (57%)
sox2NP_998283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 8/28 (29%)
SOX-TCF_HMG-box 37..108 CDD:238684 40/70 (57%)
SOXp 107..197 CDD:289133 25/110 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..263
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.