DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox14

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001286801.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:294 Identity:96/294 - (32%)
Similarity:129/294 - (43%) Gaps:81/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SRPESPTYE--NPPYEILSYSHNTPPESPHGRTADCSKNFSPSP-----------------TDNL 272
            :||.:.|.:  :|..:..|..|..||.||....|.     ||||                 |...
  Fly    30 ARPATITIQRRHPAPKADSTPHTLPPFSPSPSPAS-----SPSPAPAQTPGAQKTQSQAAITHPA 89

  Fly   273 SIASVSEAQDSEMDAPLNLSKPKGSPSSSPNSSSQRDHCENLTPVVSSPPLSWHQGQPHYAEIEL 337
            ::||.|        ||:..:.||...:..|.|:....|..:..   .|||       |..:|::.
  Fly    90 AVASPS--------APVAAAAPKTPKTPEPRSTHTHTHTHSQH---FSPP-------PRESEMDG 136

  Fly   338 PLLKSHGRVWNSAVACSGGSRATRVSRDSVNSCGTNSERSAALDPESLNSGQLG-PVPAS-PSSQ 400
            ....||           .|...| :|.|.::|              ||..|... ||.:| |.|.
  Fly   137 ERSPSH-----------SGHEMT-LSMDGIDS--------------SLVFGSARVPVNSSTPYSD 175

  Fly   401 PLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMS 465
            ..|...           ||..||||||||||||::.|||||.:..||:||:.|||.||.||:.:|
  Fly   176 ATRTKK-----------HSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLS 229

  Fly   466 NADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRT 499
            ..|||||..|..:|.||||.::|:|:|||:.|:|
  Fly   230 KDDKQPYIIEAEKLRKLHMIEYPNYKYRPQKKQT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 42/70 (60%)
Sox14NP_001286801.1 SOX-TCF_HMG-box 186..257 CDD:238684 42/70 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451306
Domainoid 1 1.000 46 1.000 Domainoid score I3058
eggNOG 1 0.900 - - E1_KOG0527
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.